Cave 15, Dashavatara. Detail of pillar shaft with leaf and foliage motif and dwarf figures at the lower portion. Ellora Caves, Aurangabad, Maharashtra India.
Cave 15, Dashavatara. Detail of pillar shaft with leaf and foliage motif and dwarf figures at the lower portion. Ellora Caves, Aurangabad, Maharashtra India.
https://www.robertharding.com/watermark.php?type=preview&im=RM/RH/VERTICAL/817-471480817-471480https://www.robertharding.com/licenses-explained/https://www.robertharding.com/preview/817-471480/cave-dashavatara-detail-pillar-shaft-leaf-foliage-motif/
lightboxBuy Personal Prints
Cave 15, Dashavatara. Detail of pillar shaft with leaf and foliage motif and dwarf figures at the lower portion. Ellora Caves, Aurangabad, Maharashtra India.


Please wait while loading pricing for this media ...


Please wait for price update...
This image is available for Editorial Use Only
Image id: 817-471480
Release status: Not Model or Property Released
Shot date: August 2013
Upload date: February 2014
Artist: Ephotocorp

 

Please wait for search history to be loaded....

 

15ancientarchaeologyarchitectureaurangabadbasaltbuddhabuddhismcapitalcarvecarvingcavecliffcourtyardcraftsmanshipdetaildwarfellorafigurefoliageheritagehinduhinduismhistorichistoryholyindiaindiankailasleaflowermaharashtramajesticmonasterymonumentmotifobeliskoldpillarporchportionreligionreligiousrockruinssacredshaftspiritualitystatuestonetourism